SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10394_internal:A_BomaMSG_c21400_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		tubulin-specific_chaperone_D_[Bombyx_mori]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0005096 F GTPase activator activity
GO:0005737 C cytoplasm
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005923 C bicellular tight junction
GO:0006457 P protein folding
GO:0007021 P tubulin complex assembly
GO:0007023 P post-chaperonin tubulin folding pathway
GO:0010812 P negative regulation of cell-substrate adhesion
GO:0016020 C membrane
GO:0016328 C lateral plasma membrane
GO:0030054 C cell junction
GO:0031115 P negative regulation of microtubule polymerization
GO:0034333 P adherens junction assembly
GO:0043547 P positive regulation of GTPase activity
GO:0048487 F beta-tubulin binding
GO:0070830 P bicellular tight junction assembly
RNA-seq EntryA_BomaMSG_c21400_g1_i1
Sequence
(Amino Acid)
CSSDLLNSNLNEENTIHYGVLAAVAAVLKHGKRDDLLPYAPKLLEWVTNQNYKHHNAMLV
RKYGVKIVQRIGLTFLRPRVAAWRYTRGSRSLAVTLGGAAAAGDRS
(34 a.a.)

- SilkBase 1999-2023 -