SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG1033_internal:A_BomaMSG_c4470_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
probable_peroxisomal_acyl-coenzyme_A_oxidase_1_[Bombyx_mori]
Ontology
GO:0000062 F fatty-acyl-CoA binding
GO:0003995 F acyl-CoA dehydrogenase activity
GO:0003997 F acyl-CoA oxidase activity
GO:0005777 C peroxisome
GO:0006091 P generation of precursor metabolites and energy
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006635 P fatty acid beta-oxidation
GO:0006693 P prostaglandin metabolic process
GO:0008152 P metabolic process
GO:0009055 F electron transfer activity
GO:0016491 F oxidoreductase activity
GO:0016627 F oxidoreductase activity, acting on the CH-CH group of donors
GO:0019395 P fatty acid oxidation
GO:0033539 P fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0033540 P fatty acid beta-oxidation using acyl-CoA oxidase
GO:0050660 F flavin adenine dinucleotide binding
GO:0052890 F oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor
GO:0055088 P lipid homeostasis
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomaMSG_c4470_g1_i1
Sequence
(Amino Acid)
ARYLVKAWKQASVGKVMTPTVAYLVDFSKNSNHIWENTPEGIIRGFHAVGAGKTQAAFEA
VQAHEKTGLDFEDAWNRASVQLVNASEAHCRAILCEMSWAEMQRLSQ
(34 a.a.)

- SilkBase 1999-2023 -