SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10309_internal:A_BomaMSG_c21337_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		ATP-binding_cassette_sub-family_G_member_1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005524 F ATP binding
GO:0005548 F phospholipid transporter activity
GO:0005654 C nucleoplasm
GO:0005739 C mitochondrion
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0006355 P regulation of transcription, DNA-templated
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0008203 P cholesterol metabolic process
GO:0009897 C external side of plasma membrane
GO:0010033 P response to organic substance
GO:0010745 P negative regulation of macrophage derived foam cell differentiation
GO:0010872 P regulation of cholesterol esterification
GO:0010875 P positive regulation of cholesterol efflux
GO:0010888 P negative regulation of lipid storage
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0017127 F cholesterol transfer activity
GO:0019534 F toxin transmembrane transporter activity
GO:0030301 P cholesterol transport
GO:0032367 P intracellular cholesterol transport
GO:0033344 P cholesterol efflux
GO:0033700 P phospholipid efflux
GO:0033993 P response to lipid
GO:0034041 F ABC-type sterol transporter activity
GO:0034374 P low-density lipoprotein particle remodeling
GO:0034375 P high-density lipoprotein particle remodeling
GO:0034436 P glycoprotein transport
GO:0034437 F obsolete glycoprotein transmembrane transporter activity
GO:0042632 P cholesterol homeostasis
GO:0042803 F protein homodimerization activity
GO:0042987 P amyloid precursor protein catabolic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0043531 F ADP binding
GO:0043691 P reverse cholesterol transport
GO:0045542 P positive regulation of cholesterol biosynthetic process
GO:0046982 F protein heterodimerization activity
GO:0055037 C recycling endosome
GO:0055091 P phospholipid homeostasis
GO:0055099 P cellular response to high density lipoprotein particle stimulus
GO:1901998 P toxin transport
RNA-seq EntryA_BomaMSG_c21337_g1_i1
Sequence
(Amino Acid)
ALPISDSLSGGQKKRLSIALELVNNPPVFFLDEPTSGLDTVTTTQCVKLLKQLARQGRTI
VCTIHQPAASLLEFFDQLYIIADGYCIYQGDTPAMVPYLESVGMPCPRHHNPADFIIELT
ENPATVKLLSQEIFNGKIYKTSKIDQNCTEPLPQMQLKVCYQAEDNAPETEIMLTNEKCV
YKVQSYSNTASMSSLSSQLSGINNSSAWMKIQKPSDYDISYSTSYFDQFSILLKRMLLQI
SRNRQGLWIQLLHHLMCGLLIGACFYNMANDGTDRKS
(91 a.a.)

- SilkBase 1999-2023 -