SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10308_3prime_partial:A_BomaMSG_c21336_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		myosin_light_chain_kinase,_smooth_muscle_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0002528 P regulation of vascular permeability involved in acute inflammatory response
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004683 F calmodulin-dependent protein kinase activity
GO:0004687 F myosin light chain kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0015629 C actin cytoskeleton
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0045214 P sarcomere organization
GO:0048769 P sarcomerogenesis
GO:0055003 P cardiac myofibril assembly
GO:0060298 P positive regulation of sarcomere organization
GO:0071347 P cellular response to interleukin-1
RNA-seq EntryA_BomaMSG_c21336_g1_i1
Sequence
(Amino Acid)
MIHVDETDPVGEIEPPFPCRDVTIKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLEL
AAKLVLVNRRDERRNVEREVDVMRRLRHPRLIQLYDAYDWGKYMCVVLELIT
(36 a.a.)

- SilkBase 1999-2023 -