SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG10305_complete:A_BomaMSG_c21334_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
ADP-ribosylation_factor-like_protein_1_[Bombyx_mori]
Ontology
GO:0000042 P protein localization to Golgi apparatus
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0007030 P Golgi organization
GO:0007264 P small GTPase mediated signal transduction
GO:0007269 P neurotransmitter secretion
GO:0007431 P salivary gland development
GO:0015031 P protein transport
GO:0016197 P endosomal transport
GO:0019904 F protein domain specific binding
GO:0030334 P regulation of cell migration
GO:0033227 P dsRNA transport
GO:0033363 P secretory granule organization
GO:0034067 P protein localization to Golgi apparatus
GO:0035220 P wing disc development
GO:0048488 P synaptic vesicle endocytosis
GO:0060628 P regulation of ER to Golgi vesicle-mediated transport
GO:0070861 P regulation of protein exit from endoplasmic reticulum
GO:0090158 P endoplasmic reticulum membrane organization
GO:0098793 C presynapse
RNA-seq EntryA_BomaMSG_c21334_g1_i2
Sequence
(Amino Acid)
MGGLFSYFRGLLGAREMRILILGLDGAGKTTILYKLQVGEVVTTIPTIGFNVEQVTYKNL
KFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLREEELANAIL
VVLANKQDMAGCLTVAEVHQALGLDALRDRTFQIFKTSAVRGEGLDQAMDWLSNALQARK
*(59 a.a.)

- SilkBase 1999-2023 -