SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10210_5prime_partial:A_BomaMSG_c21275_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		probable_histone-binding_protein_Caf1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000281 P mitotic cytokinesis
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005700 C polytene chromosome
GO:0006281 P DNA repair
GO:0006334 P nucleosome assembly
GO:0006335 P DNA replication-dependent chromatin assembly
GO:0006342 P heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007307 P eggshell chorion gene amplification
GO:0007346 P regulation of mitotic cell cycle
GO:0007379 P segment specification
GO:0007517 P muscle organ development
GO:0008284 P positive regulation of cell population proliferation
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016573 P histone acetylation
GO:0016581 C NuRD complex
GO:0016584 P nucleosome positioning
GO:0016589 C NURF complex
GO:0016590 C ACF complex
GO:0031491 F nucleosome binding
GO:0031497 P chromatin assembly
GO:0031523 C Myb complex
GO:0033186 C CAF-1 complex
GO:0035035 F histone acetyltransferase binding
GO:0035097 C histone methyltransferase complex
GO:0035098 C ESC/E(Z) complex
GO:0042054 F histone methyltransferase activity
GO:0042393 F histone binding
GO:0042766 P nucleosome mobilization
GO:0042803 F protein homodimerization activity
GO:0042826 F histone deacetylase binding
GO:0046974 F histone methyltransferase activity (H3-K9 specific)
GO:0046976 F histone methyltransferase activity (H3-K27 specific)
GO:0048666 P neuron development
GO:0048812 P neuron projection morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0051567 P histone H3-K9 methylation
GO:0061085 P regulation of histone H3-K27 methylation
GO:0070615 F ATP-dependent chromatin remodeler activity
GO:0070734 P histone H3-K27 methylation
GO:0070822 C Sin3-type complex
RNA-seq EntryA_BomaMSG_c21275_g1_i1
Sequence
(Amino Acid)
VLFRSQNPCVIATKTPSSDVLVFDYTKHPSKPEPSGECHPDLRLRGHQKEGYGLSWNPNL
NGYLLSASDDHTICLWDINATPKEGRVIEAKSVFTGHTAVVEDVAWHLLHESLFGSVADD
QKLMIWDTRCNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLK
LHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQTAEDAEDGPPELLFI
HGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPETPASELESAVNVNH
G
*(99 a.a.)

- SilkBase 1999-2023 -