SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG1020_internal:A_BomaMSG_c4389_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_histone_deacetylase_4_[Bombyx_mori]
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001570 P vasculogenesis
GO:0003682 F chromatin binding
GO:0003714 F transcription corepressor activity
GO:0004407 F histone deacetylase activity
GO:0005080 F protein kinase C binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007043 P cell-cell junction assembly
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0016787 F hydrolase activity
GO:0016925 P protein sumoylation
GO:0019789 F SUMO transferase activity
GO:0019901 F protein kinase binding
GO:0030182 P neuron differentiation
GO:0032041 F NAD-dependent histone deacetylase activity (H3-K14 specific)
GO:0032703 P negative regulation of interleukin-2 production
GO:0033613 F DNA-binding transcription factor binding
GO:0045668 P negative regulation of osteoblast differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0051402 P neuron apoptotic process
GO:0070491 F DNA-binding transcription factor binding
GO:0070932 P histone H3 deacetylation
GO:0071260 P cellular response to mechanical stimulus
GO:0071889 F 14-3-3 protein binding
GO:0090050 P positive regulation of cell migration involved in sprouting angiogenesis
GO:1901215 P negative regulation of neuron death
GO:1901223 P negative regulation of NIK/NF-kappaB signaling
RNA-seq EntryA_BomaMSG_c4389_g1_i2
Sequence
(Amino Acid)
VDSDTAWSDLHTAPAARLAAGALLDLALRTARGHLRNGFAVVRPPGHHAEPNQAMGFCFF
NNVAIAARVLHTRLGLQRILIVDWDVHHGNGTQQIFYEDPHVLYMSIHRHDDGNFFPGTG
AATECGAGPGLGYNVNVPWSCGTDPPLGDAEYLAAFRSVIMPIAKEYDPEIVLVSCGFDA
AAGHPAPLGGYSVSAACFAHMTRDLMQLANGKVVRSLEGGYDLAAMCDCAQEVVRALLGD
RPPAPPYAE
(82 a.a.)

- SilkBase 1999-2023 -