SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10194_complete:A_BomaMSG_c21260_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		mitochondrial_matrix_protein_p33_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001849 F complement component C1q complex binding
GO:0002250 P adaptive immune response
GO:0002376 P immune system process
GO:0003714 F transcription corepressor activity
GO:0003729 F mRNA binding
GO:0005540 F hyaluronic acid binding
GO:0005576 C extracellular region
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0006915 P apoptotic process
GO:0006958 P complement activation, classical pathway
GO:0008134 F transcription factor binding
GO:0008380 P RNA splicing
GO:0009986 C cell surface
GO:0014065 P phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0030449 P regulation of complement activation
GO:0030984 F kininogen binding
GO:0031690 F adrenergic receptor binding
GO:0032689 P negative regulation of interferon-gamma production
GO:0032695 P negative regulation of interleukin-12 production
GO:0039534 P negative regulation of MDA-5 signaling pathway
GO:0039536 P negative regulation of RIG-I signaling pathway
GO:0042254 P ribosome biogenesis
GO:0042256 P mature ribosome assembly
GO:0043065 P positive regulation of apoptotic process
GO:0045087 P innate immune response
GO:0045785 P positive regulation of cell adhesion
GO:0048025 P negative regulation of mRNA splicing, via spliceosome
GO:0050687 P negative regulation of defense response to virus
GO:0051897 P positive regulation of protein kinase B signaling
GO:0070131 P positive regulation of mitochondrial translation
GO:0090023 P positive regulation of neutrophil chemotaxis
GO:0097177 F mitochondrial ribosome binding
GO:1900026 P positive regulation of substrate adhesion-dependent cell spreading
GO:1901165 P positive regulation of trophoblast cell migration
GO:2000510 P positive regulation of dendritic cell chemotaxis
RNA-seq EntryA_BomaMSG_c21260_g1_i2
Sequence
(Amino Acid)
MSGIVKATHRVLQTCVKTANLSGLVSRTQTAVKRDFTRGIWHMSCSRRLDGTLASTSLLH
NHSNTCSCGCGLKALHTKGERELVEFLTEEIVAERKAQKVKTLPAEVEGFTVKGDGAEVV
LTKQLKDETIRVTFNVNHTVDSDDFEGDVQTEKQEFSEMRSKPQFEVDLVRGDTTLGFTC
SYLQDPPAASADEYNDVFGIDEITLYKGEWNDKVYAVAGDVLDGYLYDLLMNLLEEKGIS
NEFAQKLSDFSTAYEHTAYINLLESISKFTIGK
*(90 a.a.)

- SilkBase 1999-2023 -