SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG10181_internal:A_BomaMSG_c21258_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
lysine-specific_demethylase_6A_isoform_X2_[Bombyx_mori]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001701 P in utero embryonic development
GO:0001843 P neural tube closure
GO:0003007 P heart morphogenesis
GO:0003016 P respiratory system process
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0007507 P heart development
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0016491 F oxidoreductase activity
GO:0016568 P chromatin organization
GO:0021915 P neural tube development
GO:0031490 F chromatin DNA binding
GO:0032452 F histone demethylase activity
GO:0032525 P somite rostral/caudal axis specification
GO:0035097 C histone methyltransferase complex
GO:0035264 P multicellular organism growth
GO:0042802 F identical protein binding
GO:0044666 C MLL3/4 complex
GO:0046872 F metal ion binding
GO:0048333 P mesodermal cell differentiation
GO:0048568 P embryonic organ development
GO:0048570 P notochord morphogenesis
GO:0051213 F dioxygenase activity
GO:0051568 P histone H3-K4 methylation
GO:0055114 P obsolete oxidation-reduction process
GO:0060070 P canonical Wnt signaling pathway
GO:0071557 P histone H3-K27 demethylation
GO:0071558 F histone H3-tri/di-methyl-lysine-27 demethylase activity
GO:0072358 P circulatory system development
RNA-seq EntryA_BomaMSG_c21258_g1_i1
Sequence
(Amino Acid)
VLFRSVQLYMKVPGSRTPGHQENNNFCSINLNIGPGDCEWFGVPDAYWGGVRELCERHGL
SYLHGSWWPDPDELRAHGVPVYRFTQRPGDLVWVNAGCVHWVQATGWCNNIAWNVGPLTA
RQYTLALERYEWNKVQNFKSIVPMVHLTWNLARNIRVSDPRLHRAMRTCLMQTLRAAT
(58 a.a.)

- SilkBase 1999-2023 -