| Name | O_BomaMSG10147_complete:A_BomaMSG_c21242_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | BET1-like_protein_[Bombyx_mori] |
| Ontology |
| GO:0000139 |
C |
Golgi membrane |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0005789 |
C |
endoplasmic reticulum membrane |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005801 |
C |
cis-Golgi network |
| GO:0006810 |
P |
transport |
| GO:0006888 |
P |
endoplasmic reticulum to Golgi vesicle-mediated transport |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016192 |
P |
vesicle-mediated transport |
| GO:0019905 |
F |
syntaxin binding |
| GO:0031201 |
C |
SNARE complex |
| GO:0031985 |
C |
Golgi cisterna |
| GO:0048280 |
P |
vesicle fusion with Golgi apparatus |
|
| RNA-seq Entry | A_BomaMSG_c21242_g1_i1 |
Sequence
(Amino Acid) | MRRAREGYHYQPVPRVATEDTIENENERMAEELSGKISSLKYISIELGNEVRDQEKLLRG
LDDDVDRSSGFLGKTMGRVLRLGKGNHNYYIFYLFLFSIFVFFLLYIVLKFR
*(36 a.a.) |
