SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG10136_internal:A_BomaMSG_c21238_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PIN2/TRF1-interacting_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0000228 C nuclear chromosome
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0000781 C chromosome, telomeric region
GO:0000784 C chromosome, telomeric region
GO:0003676 F nucleic acid binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005819 C spindle
GO:0007004 P telomere maintenance via telomerase
GO:0007080 P mitotic metaphase plate congression
GO:0010521 F telomerase inhibitor activity
GO:0031397 P negative regulation of protein ubiquitination
GO:0031647 P regulation of protein stability
GO:0032211 P negative regulation of telomere maintenance via telomerase
GO:0043231 C intracellular membrane-bounded organelle
GO:0051974 P negative regulation of telomerase activity
GO:0070034 F telomerase RNA binding
GO:0070198 P protein localization to chromosome, telomeric region
GO:1902570 P protein localization to nucleolus
GO:1904744 P positive regulation of telomeric DNA binding
GO:1904751 P positive regulation of protein localization to nucleolus
RNA-seq EntryA_BomaMSG_c21238_g1_i1
Sequence
(Amino Acid)
RVLFRSGYEDKNDQWTKHEDDFNSLLANLSNDNGTEAKLHSGVSLEHKSKKSKARVHYHK
FTRGKDLTQYSEKDLANIFGKKSLTNDDKPQEKVQDDVKESDQKFTEKGSMEE
(36 a.a.)

- SilkBase 1999-2023 -