SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10121_5prime_partial:A_BomaMSG_c21229_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		putative_MYST_histone_acetyltransferase,_partial_[Bombyx_mori]
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0000776 C kinetochore
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008134 F transcription factor binding
GO:0010506 P regulation of autophagy
GO:0016407 F acetyltransferase activity
GO:0016568 P chromatin organization
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0016747 F acyltransferase activity, transferring groups other than amino-acyl groups
GO:0019899 F enzyme binding
GO:0030099 P myeloid cell differentiation
GO:0035064 F methylated histone binding
GO:0043981 P histone H4-K5 acetylation
GO:0043982 P histone H4-K8 acetylation
GO:0043984 P histone H4-K16 acetylation
GO:0043995 F histone acetyltransferase activity (H4-K5 specific)
GO:0043996 F histone acetyltransferase activity (H4-K8 specific)
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0046972 F histone acetyltransferase activity (H4-K16 specific)
GO:0071339 C MLL1 complex
GO:0072487 C MSL complex
RNA-seq EntryA_BomaMSG_c21229_g1_i3
Sequence
(Amino Acid)
GKLLIAFSYELSRLEQVVGSPEKPLSDLGKLSYRSYWSYVLLEVLSASRGTLSIKDLSQM
TGISQTDIISTLQSMNMVKYWKGQHVICVTPKIVAEQLASPHFKKPRLSIDPSALRWTPP
SKQGNSAKAKK
*(43 a.a.)

- SilkBase 1999-2023 -