SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10110_5prime_partial:A_BomaMSG_c21218_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		multidrug_resistance_protein_homolog_49_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006855 P xenobiotic transmembrane transport
GO:0006869 P lipid transport
GO:0008152 P metabolic process
GO:0008525 F phosphatidylcholine transporter activity
GO:0008559 F ABC-type xenobiotic transporter activity
GO:0015914 P phospholipid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0030136 C clathrin-coated vesicle
GO:0031410 C cytoplasmic vesicle
GO:0032376 P positive regulation of cholesterol transport
GO:0032782 P bile acid secretion
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042908 P xenobiotic transport
GO:0045121 C membrane raft
GO:0045332 P phospholipid translocation
GO:0055085 P transmembrane transport
GO:0055088 P lipid homeostasis
GO:0061092 P positive regulation of phospholipid translocation
GO:0090554 F phosphatidylcholine floppase activity
GO:1901557 P response to fenofibrate
GO:1903413 P cellular response to bile acid
GO:2001140 P positive regulation of phospholipid transport
RNA-seq EntryA_BomaMSG_c21218_g1_i1
Sequence
(Amino Acid)
LVGSSGCGKSTVLQHIQRFYDPTTGNIELDGVDITKSLTLNRLRKQLGVVQQEPILFDRT
LAENIAYGDNSRKPTMDEIIAAAKAANIHNFIVSLPKVHSKLIYIIQYIEHSLKLFFFSF
RLA
*(40 a.a.)

- SilkBase 1999-2023 -