SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG1000_internal:A_BomaMSG_c4263_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_probable_ubiquitin_carboxyl-terminal_hydrolase_FAF-X_isoform_X3_[Amyelois_transitella]
Ontology
GO:0004843 F thiol-dependent deubiquitinase
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006897 P endocytosis
GO:0007275 P multicellular organism development
GO:0007349 P cellularization
GO:0007601 P visual perception
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008354 P germ cell migration
GO:0008583 P mystery cell differentiation
GO:0009950 P dorsal/ventral axis specification
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0030154 P cell differentiation
GO:0035192 P nuclear cortical migration
GO:0036459 F thiol-dependent deubiquitinase
GO:0045824 P negative regulation of innate immune response
GO:0045861 P negative regulation of proteolysis
GO:0048477 P oogenesis
GO:0050829 P defense response to Gram-negative bacterium
GO:0050896 P response to stimulus
RNA-seq EntryA_BomaMSG_c4263_g1_i1
Sequence
(Amino Acid)
GGTYSDQKICKGCPHRYCKEEPFSVVSLDIRNMSRLQESLEAYVRGELLEGADAYHCDKC
NKKVVTVKRLCLNKLPPVLVIQLKRFEYDFEKVCAIKFNDYFEFPRDLDVEPYTAW
(37 a.a.)

- SilkBase 1999-2023 -