| Name | O_BomaMG4545_internal:A_BomaMG_comp17922_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_DENN_domain-containing_protein_5A_isoform_X2_[Bombyx_mori] |
| Ontology |
| GO:0000139 |
C |
Golgi membrane |
| GO:0005085 |
F |
guanyl-nucleotide exchange factor activity |
| GO:0005262 |
F |
calcium channel activity |
| GO:0005515 |
F |
protein binding |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005802 |
C |
trans-Golgi network |
| GO:0005829 |
C |
cytosol |
| GO:0016020 |
C |
membrane |
| GO:0017112 |
F |
guanyl-nucleotide exchange factor activity |
| GO:0017137 |
F |
small GTPase binding |
| GO:0030904 |
C |
retromer complex |
| GO:0042147 |
P |
retrograde transport, endosome to Golgi |
| GO:0043547 |
P |
positive regulation of GTPase activity |
| GO:0050982 |
P |
detection of mechanical stimulus |
| GO:0070588 |
P |
calcium ion transmembrane transport |
|
| RNA-seq Entry | A_BomaMG_comp17922_c0_seq1 |
Sequence
(Amino Acid) | DYFARVKDEFKMSLCDEPSTMNNKNCGGVSYNCRQDQEHRAIWRCYCHLMDEVNSVGRSL
GKDGKFQLFICLSLREHWLHRMLVPMSLTRVTAEMYEEQSFLRKRGLLTFLKQIL
(37 a.a.) |
