SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG4454_5prime_partial:A_BomaMG_comp17791_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		ryanodine_receptor_[Heliothis_virescens]
Ontology
GO:0003151 P outflow tract morphogenesis
GO:0005216 F ion channel activity
GO:0005219 F ryanodine-sensitive calcium-release channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005262 F calcium channel activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006936 P muscle contraction
GO:0007275 P multicellular organism development
GO:0014808 P release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016529 C sarcoplasmic reticulum
GO:0031000 P response to caffeine
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0033017 C sarcoplasmic reticulum membrane
GO:0042383 C sarcolemma
GO:0043588 P skin development
GO:0043931 P ossification involved in bone maturation
GO:0048741 P skeletal muscle fiber development
GO:0051209 P release of sequestered calcium ion into cytosol
GO:0051480 P regulation of cytosolic calcium ion concentration
GO:0055085 P transmembrane transport
GO:0070296 P sarcoplasmic reticulum calcium ion transport
GO:0070588 P calcium ion transmembrane transport
GO:0071313 P cellular response to caffeine
RNA-seq EntryA_BomaMG_comp17791_c0_seq1
Sequence
(Amino Acid)
AGGGIGDELEPPDGDDSEVYRIIFDISFFFFIIVILLAILQGLIIDAFGELRDQLESVKE
DMESNCFICGINKDYFDKVPHGFDTHVQREHNLANYMFFLMHLINKPDTEYTGQETYVWN
MYTQRCWDFFPVGDCFRKQYEDLMGE
*(48 a.a.)

- SilkBase 1999-2023 -