SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG36_internal:A_BomaMG_comp934_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006461 P protein-containing complex assembly
GO:0006810 P transport
GO:0006836 P neurotransmitter transport
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0007269 P neurotransmitter secretion
GO:0007601 P visual perception
GO:0010628 P positive regulation of gene expression
GO:0014047 P glutamate secretion
GO:0016020 C membrane
GO:0016079 P synaptic vesicle exocytosis
GO:0017124 F SH3 domain binding
GO:0017137 F small GTPase binding
GO:0017156 P calcium-ion regulated exocytosis
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030695 F GTPase regulator activity
GO:0042734 C presynaptic membrane
GO:0044822 F RNA binding
GO:0045055 P regulated exocytosis
GO:0045202 C synapse
GO:0046872 F metal ion binding
GO:0046903 P secretion
GO:0046928 P regulation of neurotransmitter secretion
GO:0048786 C presynaptic active zone
GO:0050790 P regulation of catalytic activity
GO:0050896 P response to stimulus
GO:0060291 P long-term synaptic potentiation
GO:0061025 P membrane fusion
GO:0097151 P positive regulation of inhibitory postsynaptic potential
GO:1903861 P positive regulation of dendrite extension
GO:2000463 P positive regulation of excitatory postsynaptic potential
RNA-seq EntryA_BomaMG_comp934_c0_seq1
Sequence
(Amino Acid)
LPDKSEKSKRRTKTLANTLEPRWNQTFVYCGIRITDIKKRTLEVTVWDLNRYGPNDFLGE
VLLDLDNIMMNHEPNWYTLKPHEDSSSFYRYREEEADGDHLSPPSTSTS
(35 a.a.)

- SilkBase 1999-2023 -