| Name | O_BomaMG3497_internal:A_BomaMG_comp16502_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | hypothetical_protein_RR48_05808_[Papilio_machaon] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0004402 |
F |
histone acetyltransferase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005730 |
C |
nucleolus |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006355 |
P |
regulation of transcription, DNA-templated |
| GO:0006364 |
P |
rRNA processing |
| GO:0007275 |
P |
multicellular organism development |
| GO:0008033 |
P |
tRNA processing |
| GO:0008080 |
F |
N-acetyltransferase activity |
| GO:0009267 |
P |
cellular response to starvation |
| GO:0016573 |
P |
histone acetylation |
| GO:0016740 |
F |
transferase activity |
| GO:0016746 |
F |
acyltransferase activity |
| GO:0022008 |
P |
neurogenesis |
|
| RNA-seq Entry | A_BomaMG_comp16502_c0_seq1 |
Sequence
(Amino Acid) | AKFYEASKKINAALNAVLEDSAAKEIGIEDKAASGAARPVQQSLQDELSKAAKDLERKQR
KELSKLMGEDLSQYRIKGSDLDWGQALASTKQKTILSVKSGEKRLGEDMK
(35 a.a.) |
