SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG3101_5prime_partial:A_BomaMG_comp15876_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC106136970_isoform_X1_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001106 F transcription corepressor activity
GO:0003682 F chromatin binding
GO:0003712 F transcription coregulator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006355 P regulation of transcription, DNA-templated
GO:0008270 F zinc ion binding
GO:0042393 F histone binding
GO:0043197 C dendritic spine
GO:0043198 C dendritic shaft
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0051491 P positive regulation of filopodium assembly
GO:0060999 P positive regulation of dendritic spine development
GO:0070491 F DNA-binding transcription factor binding
GO:0098815 P modulation of excitatory postsynaptic potential
GO:1902897 P regulation of postsynaptic density protein 95 clustering
GO:1902952 P positive regulation of dendritic spine maintenance
RNA-seq EntryA_BomaMG_comp15876_c0_seq1
Sequence
(Amino Acid)
ELSVAEMRATFEKEKQRLVMETRRLAQIELETAVKLAKSKQWCANCSQEAQFYCCWNTSY
CDYPCQRAHWSQHYSVCTQQRSEGNNNNNSDGTGAPESRSQTDKLPALQKSTVVPTLTVG
GKLASRSASQDSTPMSSIIMSMVEDVSGNQTVKCVGTYNGSKAGAVPAQIPPLIINKQIM
NEENKKVVTSGGYLIVGSTSNASVNPPRRTHTLQYFT
*(71 a.a.)

- SilkBase 1999-2023 -