SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25627_internal:A_BomaMG_comp419074_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000278 P mitotic cell cycle
GO:0000281 P mitotic cytokinesis
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005719 C euchromatin
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007030 P Golgi organization
GO:0007051 P spindle organization
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007088 P regulation of mitotic nuclear division
GO:0007098 P centrosome cycle
GO:0007099 P centriole replication
GO:0007307 P eggshell chorion gene amplification
GO:0008283 P cell population proliferation
GO:0008284 P positive regulation of cell population proliferation
GO:0010906 P regulation of glucose metabolic process
GO:0010971 P positive regulation of G2/M transition of mitotic cell cycle
GO:0030261 P chromosome condensation
GO:0031523 C Myb complex
GO:0045792 P negative regulation of cell size
GO:0045931 P positive regulation of mitotic cell cycle
GO:0051297 P centrosome cycle
GO:0090282 P positive regulation of transcription involved in G2/M transition of mitotic cell cycle
GO:0090307 P mitotic spindle assembly
RNA-seq EntryA_BomaMG_comp419074_c0_seq1
Sequence
(Amino Acid)
LEALPFSPSQFLNSPLALHAADSTPLRDAHAKEWSSSPLLHTPTPANNITPVHVNRFKTN
TPKTPTPFKIAMAEIGKKSGLKYEPSSPGLLVEDITEMIQREEKSDSTVQLSDSLLSCAA
EHEGGAQGNDSGIGSLKR
(45 a.a.)

- SilkBase 1999-2023 -