SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25545_internal:A_BomaMG_comp384226_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0001669 C acrosomal vesicle
GO:0001701 P in utero embryonic development
GO:0001708 P cell fate specification
GO:0001726 C ruffle
GO:0001894 P tissue homeostasis
GO:0001948 F protein binding
GO:0001968 F fibronectin binding
GO:0002020 F protease binding
GO:0002042 P cell migration involved in sprouting angiogenesis
GO:0003779 F actin binding
GO:0004872 F signaling receptor activity
GO:0005102 F signaling receptor binding
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005518 F collagen binding
GO:0005604 C basement membrane
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005912 C adherens junction
GO:0005925 C focal adhesion
GO:0006874 P cellular calcium ion homeostasis
GO:0007155 P cell adhesion
GO:0007159 P leukocyte cell-cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0007161 P calcium-independent cell-matrix adhesion
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007229 P integrin-mediated signaling pathway
GO:0008277 P regulation of G protein-coupled receptor signaling pathway
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0008305 C integrin complex
GO:0008354 P germ cell migration
GO:0008542 P visual learning
GO:0009897 C external side of plasma membrane
GO:0009986 C cell surface
GO:0010710 P regulation of collagen catabolic process
GO:0010811 P positive regulation of cell-substrate adhesion
GO:0010976 P positive regulation of neuron projection development
GO:0014704 C intercalated disc
GO:0014823 P response to activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016477 P cell migration
GO:0019900 F kinase binding
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0019960 F C-X3-C chemokine binding
GO:0021943 P formation of radial glial scaffolds
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030056 C hemidesmosome
GO:0030175 C filopodium
GO:0030335 P positive regulation of cell migration
GO:0031175 P neuron projection development
GO:0031345 P negative regulation of cell projection organization
GO:0031410 C cytoplasmic vesicle
GO:0031589 P cell-substrate adhesion
GO:0031594 C neuromuscular junction
GO:0031623 P receptor internalization
GO:0031667 P response to nutrient levels
GO:0032403 F protein-containing complex binding
GO:0032587 C ruffle membrane
GO:0032594 P protein transport within lipid bilayer
GO:0033631 P cell-cell adhesion mediated by integrin
GO:0034113 P heterotypic cell-cell adhesion
GO:0034665 C integrin alpha1-beta1 complex
GO:0034666 C integrin alpha2-beta1 complex
GO:0034667 C integrin alpha3-beta1 complex
GO:0034677 C integrin alpha7-beta1 complex
GO:0034679 C integrin alpha9-beta1 complex
GO:0034680 C integrin alpha10-beta1 complex
GO:0034681 C integrin alpha11-beta1 complex
GO:0034698 P response to gonadotropin
GO:0035024 P negative regulation of Rho protein signal transduction
GO:0035748 C myelin sheath abaxonal region
GO:0042277 F peptide binding
GO:0042383 C sarcolemma
GO:0042470 C melanosome
GO:0042493 P response to xenobiotic stimulus
GO:0042995 C cell projection
GO:0043065 P positive regulation of apoptotic process
GO:0043149 P stress fiber assembly
GO:0043197 C dendritic spine
GO:0043235 C receptor complex
GO:0043236 F laminin binding
GO:0043410 P positive regulation of MAPK cascade
GO:0043547 P positive regulation of GTPase activity
GO:0045121 C membrane raft
GO:0045202 C synapse
GO:0045214 P sarcomere organization
GO:0045596 P negative regulation of cell differentiation
GO:0045665 P negative regulation of neuron differentiation
GO:0045666 P positive regulation of neuron differentiation
GO:0045807 P positive regulation of endocytosis
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048333 P mesodermal cell differentiation
GO:0048471 C perinuclear region of cytoplasm
GO:0048675 P axon extension
GO:0048738 P cardiac muscle tissue development
GO:0048813 P dendrite morphogenesis
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050839 F cell adhesion molecule binding
GO:0050901 P leukocyte tethering or rolling
GO:0051393 F alpha-actinin binding
GO:0051726 P regulation of cell cycle
GO:0055007 P cardiac muscle cell differentiation
GO:0055037 C recycling endosome
GO:0060135 P maternal process involved in female pregnancy
GO:0070062 C extracellular exosome
GO:0070830 P bicellular tight junction assembly
GO:0071260 P cellular response to mechanical stimulus
GO:0071305 P cellular response to vitamin D
GO:0071404 P cellular response to low-density lipoprotein particle stimulus
GO:0071438 C obsolete invadopodium membrane
GO:0071479 P cellular response to ionizing radiation
GO:0071559 P response to transforming growth factor beta
GO:0090004 P positive regulation of protein localization to plasma membrane
GO:0097060 C synaptic membrane
GO:0098639 F collagen binding involved in cell-matrix adhesion
GO:2000811 P negative regulation of anoikis
RNA-seq EntryA_BomaMG_comp384226_c0_seq1
Sequence
(Amino Acid)
TPGHIKIKVRPGVPVDFKMLYKPIEHFPLDVYFLMDNSYTMRQFQNELKSQAINILKELS
AFTKNVRLGFGTFVEKPVYPYYDKNRYQKSIPFENVLSLTADISKL
(34 a.a.)

- SilkBase 1999-2023 -