SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25524_internal:A_BomaMG_comp381170_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001502 P cartilage condensation
GO:0001503 P ossification
GO:0002063 P chondrocyte development
GO:0003007 P heart morphogenesis
GO:0005201 F extracellular matrix structural constituent
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005581 C collagen trimer
GO:0005592 C collagen type XI trimer
GO:0005788 C endoplasmic reticulum lumen
GO:0006029 P proteoglycan metabolic process
GO:0007601 P visual perception
GO:0007605 P sensory perception of sound
GO:0030198 P extracellular matrix organization
GO:0030199 P collagen fibril organization
GO:0030574 P collagen catabolic process
GO:0030674 F protein-macromolecule adaptor activity
GO:0031012 C extracellular matrix
GO:0035987 P endodermal cell differentiation
GO:0035989 P tendon development
GO:0042472 P inner ear morphogenesis
GO:0046872 F metal ion binding
GO:0048704 P embryonic skeletal system morphogenesis
GO:0048705 P skeletal system morphogenesis
GO:0050840 F extracellular matrix binding
GO:0050910 P detection of mechanical stimulus involved in sensory perception of sound
GO:0051216 P cartilage development
GO:0055010 P ventricular cardiac muscle tissue morphogenesis
RNA-seq EntryA_BomaMG_comp381170_c0_seq1
Sequence
(Amino Acid)
GIIVARSTLETVKSPRGTRSNPALSCKDLKTSFPNITDGDYWIDARGGSGSGRPIKAYCK
GYSTCLYPDVKEQSVYSNDANTHKFSQMKNGFRISYDAEGSGAIQLRF
(35 a.a.)

- SilkBase 1999-2023 -