SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25519_internal:A_BomaMG_comp380155_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000124 C SAGA complex
GO:0000775 C chromosome, centromeric region
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005671 C obsolete Ada2/Gcn5/Ada3 transcription activator complex
GO:0005829 C cytosol
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008080 F N-acetyltransferase activity
GO:0010484 F H3 histone acetyltransferase activity
GO:0016568 P chromatin organization
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0032968 P positive regulation of transcription elongation from RNA polymerase II promoter
GO:0043966 P histone H3 acetylation
GO:0046695 C SLIK (SAGA-like) complex
GO:0070577 F lysine-acetylated histone binding
RNA-seq EntryA_BomaMG_comp380155_c0_seq1
Sequence
(Amino Acid)
GRKPKHEKLNMSNGKDRRSKNSLTNGVHEERAARGPDAVQQLLRDVIKHKDSWPFYEPVS
IEDVPDYLDVIDQPMDLTTIKEKLEKSQYSADEELIADIALIFHNCYTYNTDT
(36 a.a.)

- SilkBase 1999-2023 -