SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25468_internal:A_BomaMG_comp336584_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004707 F MAP kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0008134 F transcription factor binding
GO:0016055 P Wnt signaling pathway
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018107 P peptidyl-threonine phosphorylation
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0031625 F ubiquitin protein ligase binding
GO:0033136 P serine phosphorylation of STAT protein
GO:0035556 P intracellular signal transduction
GO:0042169 F SH2 domain binding
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0050821 P protein stabilization
RNA-seq EntryA_BomaMG_comp336584_c0_seq1
Sequence
(Amino Acid)
ADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDANKNM
TQEVVTQYYRAPEILMGANHYTAAVDVWSVGCIFGELLGRRILFQAQSPVQQLELITDLL
GTPSLE
(41 a.a.)

- SilkBase 1999-2023 -