SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25405_internal:A_BomaMG_comp319462_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001525 P angiogenesis
GO:0001886 P endothelial cell morphogenesis
GO:0005198 F structural molecule activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005581 C collagen trimer
GO:0005604 C basement membrane
GO:0005615 C extracellular space
GO:0005788 C endoplasmic reticulum lumen
GO:0007155 P cell adhesion
GO:0007601 P visual perception
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0009887 P animal organ morphogenesis
GO:0030198 P extracellular matrix organization
GO:0030335 P positive regulation of cell migration
GO:0030574 P collagen catabolic process
GO:0031012 C extracellular matrix
GO:0042493 P response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0046872 F metal ion binding
GO:0051599 P response to hydrostatic pressure
GO:0070062 C extracellular exosome
GO:2000353 P positive regulation of endothelial cell apoptotic process
RNA-seq EntryA_BomaMG_comp319462_c0_seq1
Sequence
(Amino Acid)
SMYQPSRSAPRLVPYNQPSKSPNDKRYIRLAALNEPYSGRMETHLNRVGYSAINYECHRQ
SMRDYNGTFVAVLSNRVTDLISLVKPSERNIPVTNLKGEILYPSWSSIFDG
(36 a.a.)

- SilkBase 1999-2023 -