SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25340_internal:A_BomaMG_comp311705_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0003384 P apical constriction involved in gastrulation
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005913 C adherens junction
GO:0007016 P obsolete cytoskeletal anchoring at plasma membrane
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007275 P multicellular organism development
GO:0007369 P gastrulation
GO:0007399 P nervous system development
GO:0008013 F beta-catenin binding
GO:0009792 P embryo development ending in birth or egg hatching
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016342 C catenin complex
GO:0016477 P cell migration
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0042074 P cell migration involved in gastrulation
GO:0070097 F delta-catenin binding
RNA-seq EntryA_BomaMG_comp311705_c0_seq1
Sequence
(Amino Acid)
SQATYNLVVEAWDNYQFGYLSGESRNAFKQIVVHVEDVNDNPPILHVPPDCTTITEFHNH
REPIVSVSASDADDNSTPNGRVQFHLVAGKGQDLFRFEQVGGDANTGRLFARQ
(36 a.a.)

- SilkBase 1999-2023 -