SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25290_internal:A_BomaMG_comp278605_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005509 F calcium ion binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006355 P regulation of transcription, DNA-templated
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0021999 P neural plate anterior/posterior regionalization
GO:0022407 P regulation of cell-cell adhesion
GO:0048813 P dendrite morphogenesis
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
RNA-seq EntryA_BomaMG_comp278605_c0_seq1
Sequence
(Amino Acid)
KCKDPCIGTCGTDAICETINHIPMCSCPSGFTGSPFSYCTQILELPTPVNLCVPSPCGPN
SQCRELNGHAVCVCVSGYLGSPPNCRPECILSSDCKLNEACSNQKCIDP
(35 a.a.)

- SilkBase 1999-2023 -