SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG25012_internal:A_BomaMG_comp234127_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC106129198_[Amyelois_transitella]
Ontology
GO:0001932 P regulation of protein phosphorylation
GO:0005158 F insulin receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0007010 P cytoskeleton organization
GO:0008284 P positive regulation of cell population proliferation
GO:0008286 P insulin receptor signaling pathway
GO:0008360 P regulation of cell shape
GO:0022604 P regulation of cell morphogenesis
GO:0043066 P negative regulation of apoptotic process
GO:0043568 P positive regulation of insulin-like growth factor receptor signaling pathway
GO:0045840 P positive regulation of mitotic nuclear division
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0070062 C extracellular exosome
GO:0070577 F lysine-acetylated histone binding
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp234127_c0_seq1
Sequence
(Amino Acid)
KYFEAVSEKDVYKVNPRDKPWERTQIYDCELVKVVGVKYVIKPPRLVCLRLSCLEGARPR
SFTVKYHDMADVIDFLVLRQQFDAAAARRWNAGDRFRCMIDDSWW
(34 a.a.)

- SilkBase 1999-2023 -