SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG24793_internal:A_BomaMG_comp200048_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_glutamine_synthetase_2_cytoplasmic_[Papilio_machaon]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0001504 P neurotransmitter uptake
GO:0003824 F catalytic activity
GO:0004351 F glutamate decarboxylase activity
GO:0004356 F glutamate-ammonia ligase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005791 C rough endoplasmic reticulum
GO:0005829 C cytosol
GO:0006536 P glutamate metabolic process
GO:0006538 P glutamate catabolic process
GO:0006542 P glutamine biosynthetic process
GO:0006807 P nitrogen compound metabolic process
GO:0008283 P cell population proliferation
GO:0008652 P cellular amino acid biosynthetic process
GO:0009267 P cellular response to starvation
GO:0009749 P response to glucose
GO:0016595 F glutamate binding
GO:0016829 F lyase activity
GO:0016874 F ligase activity
GO:0019676 P ammonia assimilation cycle
GO:0030145 F manganese ion binding
GO:0032024 P positive regulation of insulin secretion
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043204 C perikaryon
GO:0043209 C myelin sheath
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043679 C axon terminus
GO:0044297 C cell body
GO:0045503 F dynein light chain binding
GO:0050679 P positive regulation of epithelial cell proliferation
GO:0051260 P protein homooligomerization
GO:0051968 P positive regulation of synaptic transmission, glutamatergic
GO:0070062 C extracellular exosome
GO:0097386 C glial cell projection
RNA-seq EntryA_BomaMG_comp200048_c0_seq1
Sequence
(Amino Acid)
GVPITGTHAEAMLSQWEFQVGPSVGVSAGDDLWIARFILHRLAEEFGVIVTFDPKPVSDW
NGSGAHHNFSTKKMRDEGGITEIERAIEKLSKVHMKHIKVYDPRGGKDNERRLTGLHETA
SIHDFSSGVASRSASIRIPRQVEAEKRGYLEDRRPASNC
(52 a.a.)

- SilkBase 1999-2023 -