SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG24648_internal:A_BomaMG_comp181476_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_liprin-alpha-1_[Bombyx_mori]
Ontology
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007274 P neuromuscular synaptic transmission
GO:0007626 P locomotory behavior
GO:0008088 P axo-dendritic transport
GO:0008104 P protein localization
GO:0018991 P oviposition
GO:0019894 F kinesin binding
GO:0030054 C cell junction
GO:0030159 F signaling receptor complex adaptor activity
GO:0030424 C axon
GO:0040011 P locomotion
GO:0042803 F protein homodimerization activity
GO:0043113 P receptor clustering
GO:0045202 C synapse
GO:0048489 P synaptic vesicle transport
GO:0048786 C presynaptic active zone
GO:0050803 P regulation of synapse structure or activity
GO:0050808 P synapse organization
GO:0097445 C presynaptic active zone dense projection
GO:1903744 P positive regulation of anterograde synaptic vesicle transport
GO:2000582 P obsolete positive regulation of microtubule motor activity, plus-end-directed
RNA-seq EntryA_BomaMG_comp181476_c0_seq1
Sequence
(Amino Acid)
LTSPSAPRGTACAALAFGDMNHEWIGNVWLPSLGLPQYRTTFMECLVDARMLEHLTKRDL
RTQLKMVDSFHRTSLHFGVACLKRVGYSVRALEERRRAAEGG
(33 a.a.)

- SilkBase 1999-2023 -