SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG24340_internal:A_BomaMG_comp149200_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_A-kinase_anchor_protein_13_[Bombyx_mori]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0000902 P cell morphogenesis
GO:0002376 P immune system process
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0005923 C bicellular tight junction
GO:0005925 C focal adhesion
GO:0006886 P intracellular protein transport
GO:0007015 P actin filament organization
GO:0007026 P negative regulation of microtubule depolymerization
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008017 F microtubule binding
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0017048 F small GTPase binding
GO:0030054 C cell junction
GO:0030676 F guanyl-nucleotide exchange factor activity
GO:0031410 C cytoplasmic vesicle
GO:0031982 C vesicle
GO:0032587 C ruffle membrane
GO:0032755 P positive regulation of interleukin-6 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0035023 P regulation of Rho protein signal transduction
GO:0035556 P intracellular signal transduction
GO:0042127 P regulation of cell population proliferation
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0043065 P positive regulation of apoptotic process
GO:0043198 C dendritic shaft
GO:0043234 C protein-containing complex
GO:0043547 P positive regulation of GTPase activity
GO:0045087 P innate immune response
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048365 F small GTPase binding
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050768 P negative regulation of neurogenesis
GO:0051056 P regulation of small GTPase mediated signal transduction
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051301 P cell division
GO:0060546 P negative regulation of necroptotic process
GO:0071225 P cellular response to muramyl dipeptide
GO:0071356 P cellular response to tumor necrosis factor
GO:0071474 P cellular hyperosmotic response
GO:0097481 C postsynaptic density
GO:1902042 P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:1902219 P negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress
RNA-seq EntryA_BomaMG_comp149200_c0_seq1
Sequence
(Amino Acid)
GGAHCDWCSRPLNDTPALYCDNCGTTVHQNICKDYIVDCNKPKSSKTSVGKSLSAASGKS
SKRSSVSGQSQTNSTSHIYNDDKDSDHKHDQSNASDDACAAEWPEVYLGPEQLGDEALVL
GLGASEPDTWAAGAPKGLAKSLGERETKRQEHIYELILTEKHHCLTIRLMQKMFADGMVR
FGSVSSAQVARMFPRVDE
(65 a.a.)

- SilkBase 1999-2023 -