| Name | O_BomaMG24121_internal:A_BomaMG_comp131776_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_E3_ubiquitin-protein_ligase_MIB1_[Bombyx_mori] |
| Ontology |
| GO:0001568 |
P |
blood vessel development |
| GO:0001701 |
P |
in utero embryonic development |
| GO:0001756 |
P |
somitogenesis |
| GO:0001841 |
P |
neural tube formation |
| GO:0001947 |
P |
heart looping |
| GO:0004842 |
F |
ubiquitin-protein transferase activity |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005813 |
C |
centrosome |
| GO:0005815 |
C |
microtubule organizing center |
| GO:0005829 |
C |
cytosol |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005886 |
C |
plasma membrane |
| GO:0006897 |
P |
endocytosis |
| GO:0007219 |
P |
Notch signaling pathway |
| GO:0007507 |
P |
heart development |
| GO:0008270 |
F |
zinc ion binding |
| GO:0014069 |
C |
postsynaptic density |
| GO:0016020 |
C |
membrane |
| GO:0016567 |
P |
protein ubiquitination |
| GO:0016874 |
F |
ligase activity |
| GO:0031410 |
C |
cytoplasmic vesicle |
| GO:0045665 |
P |
negative regulation of neuron differentiation |
| GO:0045807 |
P |
positive regulation of endocytosis |
| GO:0046872 |
F |
metal ion binding |
|
| RNA-seq Entry | A_BomaMG_comp131776_c0_seq1 |
Sequence
(Amino Acid) | PTGGAGAAGAGGGFAVGDLVQVCADQERVKALQRGHGEWAEAMAPTLGKIGRVQQIYHDN
DLKVEVCNTSWTYNPNAVTKVASSDGSIPGNSSGERLSALLKKLFESHVTGDANEELVKA
AANGDATR
(41 a.a.) |
