SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG23765_3prime_partial:A_BomaMG_comp108302_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_TBC1_domain_family_member_20,_partial_[Bombyx_mori]
Ontology
GO:0001675 P acrosome assembly
GO:0002088 P lens development in camera-type eye
GO:0005096 F GTPase activator activity
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007030 P Golgi organization
GO:0007283 P spermatogenesis
GO:0008584 P male gonad development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017137 F small GTPase binding
GO:0019068 P virion assembly
GO:0030173 C integral component of Golgi membrane
GO:0031965 C nuclear membrane
GO:0034389 P lipid droplet organization
GO:0043010 P camera-type eye development
GO:0043547 P positive regulation of GTPase activity
GO:0044829 P positive regulation by host of viral genome replication
GO:0046726 P positive regulation by virus of viral protein levels in host cell
GO:0070309 P lens fiber cell morphogenesis
GO:0072520 P seminiferous tubule development
GO:0090110 P COPII-coated vesicle cargo loading
GO:1902953 P positive regulation of ER to Golgi vesicle-mediated transport
RNA-seq EntryA_BomaMG_comp108302_c0_seq1
Sequence
(Amino Acid)
MESNNKDSEVIDKSVMNGECSPAESIHPTNLNKTKNIDVISTPSELKFDNEPEEEDPEIV
EKRKEIEECLSDVDSVDVEKWKNLARSKGGLICDEYRRRIWPLLVGVTKEEMTEAPSLDE
LSTHPEYNQVVLDVNRSLKRFPPGIPYEQRVALQDQLTVLILRVIIKYPHLKYYQGYHDV
AITLLLVCGDRASFPLLCRLSYGAGAPLAPFMQLTMQPTQHLLNYMLPVVGRANTKLANR
LEEAGVGTMFALPWYLTWFGHSLE
(87 a.a.)

- SilkBase 1999-2023 -