SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG234_3prime_partial:A_BomaMG_comp2409_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001558 P regulation of cell growth
GO:0001745 P compound eye morphogenesis
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0001934 P positive regulation of protein phosphorylation
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005938 C cell cortex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006897 P endocytosis
GO:0007050 P regulation of cell cycle
GO:0007112 P male meiosis cytokinesis
GO:0007267 P cell-cell signaling
GO:0007283 P spermatogenesis
GO:0007291 P sperm individualization
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008092 F cytoskeletal protein binding
GO:0008101 P BMP signaling pathway
GO:0008285 P negative regulation of cell population proliferation
GO:0009798 P axis specification
GO:0009966 P regulation of signal transduction
GO:0016006 C Nebenkern
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0019094 P pole plasm mRNA localization
GO:0019898 C extrinsic component of membrane
GO:0030054 C cell junction
GO:0032456 P endocytic recycling
GO:0035329 P hippo signaling
GO:0035330 P regulation of hippo signaling
GO:0036375 C Kibra-Ex-Mer complex
GO:0042048 P olfactory behavior
GO:0042127 P regulation of cell population proliferation
GO:0042327 P positive regulation of phosphorylation
GO:0042802 F identical protein binding
GO:0042981 P regulation of apoptotic process
GO:0045169 C fusome
GO:0045595 P regulation of cell differentiation
GO:0046621 P negative regulation of organ growth
GO:0046669 P regulation of compound eye retinal cell programmed cell death
GO:0051307 P meiotic chromosome separation
GO:0060253 P negative regulation of glial cell proliferation
GO:0072659 P protein localization to plasma membrane
RNA-seq EntryA_BomaMG_comp2409_c0_seq1
Sequence
(Amino Acid)
MPPFRRKKAAKSFPVKVCTLDAELEFNLEWRATGRDLFDLVCRTIGLRETWFFGLQFEDT
KHFISWLKLDKRVQDQCVSQMPGTPFMLLCKLYPEDVAEELIQEVTQHLLFLQVKQAILS
MDIYCPPEASVLLASYAVQAKYGDYDESAYKPGML
(50 a.a.)

- SilkBase 1999-2023 -