| Name | O_BomaMG2327_internal:A_BomaMG_comp13747_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_probable_ATP-dependent_RNA_helicase_YTHDC2_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003723 |
F |
RNA binding |
| GO:0004004 |
F |
RNA helicase activity |
| GO:0004386 |
F |
helicase activity |
| GO:0005515 |
F |
protein binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0006396 |
P |
RNA processing |
| GO:0008186 |
F |
ATP-dependent activity, acting on RNA |
| GO:0016787 |
F |
hydrolase activity |
| GO:0034612 |
P |
response to tumor necrosis factor |
| GO:0044822 |
F |
RNA binding |
| GO:0044829 |
P |
positive regulation by host of viral genome replication |
| GO:0070063 |
F |
RNA polymerase binding |
| GO:0070555 |
P |
response to interleukin-1 |
| GO:1990247 |
F |
N6-methyladenosine-containing RNA binding |
|
| RNA-seq Entry | A_BomaMG_comp13747_c0_seq1 |
Sequence
(Amino Acid) | ISVCYLRQKLCALVIRRMSNPAKPTTPLDDQILNTVVHILGAEEKNVGLSQPSGIGQRPK
PLTLDSPNWRMRVEEDQYRHDKYYPQYSQPEYQNTFYPNYFRNGQGRPGWRGDVMPQGFS
PQYNGPKSPMSPNGKVMMPNMEKYGEGAEGNAKQFMIKVDELHAL
(54 a.a.) |
