SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG23173_complete:A_BomaMG_comp78184_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000793 C condensed chromosome
GO:0001666 P response to hypoxia
GO:0004418 F hydroxymethylbilane synthase activity
GO:0004852 F uroporphyrinogen-III synthase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006779 P porphyrin-containing compound biosynthetic process
GO:0006782 P protoporphyrinogen IX biosynthetic process
GO:0006783 P heme biosynthetic process
GO:0009725 P response to hormone
GO:0009743 P response to carbohydrate
GO:0010038 P response to metal ion
GO:0010043 P response to zinc ion
GO:0010288 P response to lead ion
GO:0014070 P response to organic cyclic compound
GO:0016740 F transferase activity
GO:0018160 P peptidyl-pyrromethane cofactor linkage
GO:0030424 C axon
GO:0031100 P animal organ regeneration
GO:0031406 F carboxylic acid binding
GO:0031667 P response to nutrient levels
GO:0032025 P response to cobalt ion
GO:0032355 P response to estradiol
GO:0033014 P tetrapyrrole biosynthetic process
GO:0033273 P response to vitamin
GO:0042493 P response to xenobiotic stimulus
GO:0043176 F amine binding
GO:0043200 P response to amino acid
GO:0048708 P astrocyte differentiation
GO:0050662 F obsolete coenzyme binding
GO:0051597 P response to methylmercury
GO:0071236 P cellular response to antibiotic
GO:0071243 P cellular response to arsenic-containing substance
GO:0071284 P cellular response to lead ion
GO:0071345 P cellular response to cytokine stimulus
GO:0071418 P cellular response to amine stimulus
GO:0071549 P cellular response to dexamethasone stimulus
RNA-seq EntryA_BomaMG_comp78184_c0_seq1
Sequence
(Amino Acid)
MDGETKLSIHVGSRKSELALVQTNFVIDSLKRNYPEKEFKIVTMTTLGDRVLDQPLPKIG
EKSLFTKDLEDALMSKNVDFVVHSLKDLPTTLPDGLVIGAVFEREDPRDALVLKEKFKEY
SLSTLPSGSVIGTSSLRRTAQLNGNYPQLKVVDVRGNLNTRLRKLDDEDGKYSALILASA
GLSRMGWGNRMSKVLPCSEMLYAVGQGALAVECRADNEEVLAMLAPFNHPETYCRVLAER
SFLKTLGGGCSAPVGISTKLKQNDNVYKLTLTGAVWSLDGSTKLEETLDQTFGQIRKTVK
HKLSPTEEASSKKIKTDKTVEADNEIAVLNRRISEKTGDLGCEDLAPNVADRRCFCGLTA
NVNMPIDVVIKCDNLGRDLANSLIDKGALEVMKISQDIIRSSIGKKS
*(135 a.a.)

- SilkBase 1999-2023 -