SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG23171_internal:A_BomaMG_comp78115_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0001843 P neural tube closure
GO:0003205 P cardiac chamber development
GO:0003408 P optic cup formation involved in camera-type eye development
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006325 P chromatin organization
GO:0006337 P nucleosome disassembly
GO:0006338 P chromatin remodeling
GO:0006344 P obsolete heterochromatin maintenance
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007399 P nervous system development
GO:0016514 C SWI/SNF complex
GO:0016568 P chromatin organization
GO:0016922 F nuclear receptor binding
GO:0030520 P intracellular estrogen receptor signaling pathway
GO:0030521 P androgen receptor signaling pathway
GO:0030900 P forebrain development
GO:0031491 F nucleosome binding
GO:0042921 P glucocorticoid receptor signaling pathway
GO:0043044 P chromatin remodeling
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0055007 P cardiac muscle cell differentiation
GO:0060674 P placenta blood vessel development
GO:0071564 C npBAF complex
GO:0071565 C nBAF complex
GO:0090544 C SWI/SNF superfamily-type complex
GO:1901998 P toxin transport
RNA-seq EntryA_BomaMG_comp78115_c0_seq1
Sequence
(Amino Acid)
AGPQPPPAWTHQPYPSQTSGGPTWGGAPRPPTQDGYPPSSVPSTGVTTAGTQIKRELTFP
TECVEGTVPSAEKRRRLTRADVAPVDAWRIMMALKSGLLAETCWALDILNILLFDDNCIG
YFGLQHMPGLLDLLLEHFHRSLSDVFDAPPTDEDPWYAPPRSPTPPPAPRPA
(56 a.a.)

- SilkBase 1999-2023 -