SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG23078_internal:A_BomaMG_comp72711_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000189 P obsolete MAPK import into nucleus
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0003682 F chromatin binding
GO:0003729 F mRNA binding
GO:0005215 F transporter activity
GO:0005487 F structural constituent of nuclear pore
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005868 C cytoplasmic dynein complex
GO:0006404 P RNA import into nucleus
GO:0006405 P RNA export from nucleus
GO:0006606 P protein import into nucleus
GO:0006611 P protein export from nucleus
GO:0006810 P transport
GO:0006999 P nuclear pore organization
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0010965 P regulation of mitotic sister chromatid separation
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0019898 C extrinsic component of membrane
GO:0031072 F heat shock protein binding
GO:0031453 P positive regulation of heterochromatin assembly
GO:0031647 P regulation of protein stability
GO:0031965 C nuclear membrane
GO:0031990 P mRNA export from nucleus in response to heat stress
GO:0034399 C nuclear periphery
GO:0034605 P cellular response to heat
GO:0042306 P regulation of protein import into nucleus
GO:0042307 P positive regulation of protein import into nucleus
GO:0042405 C nuclear inclusion body
GO:0042803 F protein homodimerization activity
GO:0043495 F protein-membrane adaptor activity
GO:0043578 P nuclear matrix organization
GO:0044615 C nuclear pore nuclear basket
GO:0045947 P negative regulation of translational initiation
GO:0046827 P positive regulation of protein export from nucleus
GO:0046832 P negative regulation of RNA export from nucleus
GO:0051019 F mitogen-activated protein kinase binding
GO:0051028 P mRNA transport
GO:0051292 P nuclear pore complex assembly
GO:0051301 P cell division
GO:0070849 P response to epidermal growth factor
GO:0072686 C mitotic spindle
GO:0090267 P positive regulation of mitotic cell cycle spindle assembly checkpoint
GO:0090316 P positive regulation of intracellular protein transport
GO:1901673 P regulation of mitotic spindle assembly
RNA-seq EntryA_BomaMG_comp72711_c0_seq1
Sequence
(Amino Acid)
ASVSPPPPGVTTSHPPPDARPPKRRLQPRPTATKRTRVQGFERSVEVEYQVPTSSRCDQD
DEGVIVVDSEEDDERCTGTMYREGEEDEEDVEEEQEVEGADDEEEVEGDDSENTAQQDSP
VQSPEAGAEPTPAPPAPPQQQIEAISSGTEPSGALSLGGNGADDGDDSIVPSTPTLYVPR
RNDGFGEAVVSPVGGADARFTFSEATGADAAPLQHHD
(71 a.a.)

- SilkBase 1999-2023 -