SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22916_3prime_partial:A_BomaMG_comp62313_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000502 C proteasome complex
GO:0004843 F thiol-dependent deubiquitinase
GO:0004866 F endopeptidase inhibitor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0007268 P chemical synaptic transmission
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0009986 C cell surface
GO:0010951 P negative regulation of endopeptidase activity
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0036459 F thiol-dependent deubiquitinase
GO:0045202 C synapse
GO:0050920 P regulation of chemotaxis
GO:0061136 P regulation of proteasomal protein catabolic process
GO:0070062 C extracellular exosome
GO:0070628 F proteasome binding
GO:1903070 P negative regulation of ER-associated ubiquitin-dependent protein catabolic process
RNA-seq EntryA_BomaMG_comp62313_c0_seq1
Sequence
(Amino Acid)
MPNVSVKVKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVVCKGVTLRDDTWGN
FKLTNNALVLVMGSKEEDVPAAPVEQTRFVEDMNEAELATAMDMPEGLINLGNTCYMNAT
VQCLKTVPELRNALLNYDKSSTGGDTAGELTAALSETVSALDSGGSSACGVAA
(56 a.a.)

- SilkBase 1999-2023 -