SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22914_internal:A_BomaMG_comp62195_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001676 P long-chain fatty acid metabolic process
GO:0003824 F catalytic activity
GO:0004467 F long-chain fatty acid-CoA ligase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005811 C lipid droplet
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006641 P triglyceride metabolic process
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0008610 P lipid biosynthetic process
GO:0015908 P fatty acid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016874 F ligase activity
GO:0030182 P neuron differentiation
GO:0030307 P positive regulation of cell growth
GO:0031090 C organelle membrane
GO:0031957 F very long-chain fatty acid-CoA ligase activity
GO:0031966 C mitochondrial membrane
GO:0032307 P negative regulation of prostaglandin secretion
GO:0035338 P long-chain fatty-acyl-CoA biosynthetic process
GO:0043025 C neuronal cell body
GO:0043231 C intracellular membrane-bounded organelle
GO:0044233 C mitochondria-associated endoplasmic reticulum membrane
GO:0047676 F arachidonate-CoA ligase activity
GO:0060136 P embryonic process involved in female pregnancy
GO:0060996 P dendritic spine development
GO:0070062 C extracellular exosome
GO:0070672 P response to interleukin-15
RNA-seq EntryA_BomaMG_comp62195_c0_seq1
Sequence
(Amino Acid)
AGALLALRDWDEGNYRVTNKPHPQGEIIIGGDCVAEGYYKNPQKTKEEFVDAEGRRWFKS
GDIGELHDDGCIKIIDRKKDLVKLQAGEYVSLGKVEAELKTCPIVENICVYGDSSKSHTV
ALVVPNAPRLAA
(43 a.a.)

- SilkBase 1999-2023 -