SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22903_5prime_partial:A_BomaMG_comp61696_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001541 P ovarian follicle development
GO:0003743 F translation initiation factor activity
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005737 C cytoplasm
GO:0005851 C eukaryotic translation initiation factor 2B complex
GO:0006412 P translation
GO:0006413 P translational initiation
GO:0009408 P response to heat
GO:0009749 P response to glucose
GO:0014003 P oligodendrocyte development
GO:0019509 P L-methionine salvage from methylthioadenosine
GO:0021766 P hippocampus development
GO:0031369 F translation initiation factor binding
GO:0042552 P myelination
GO:0043434 P response to peptide hormone
GO:0043547 P positive regulation of GTPase activity
GO:0044237 P cellular metabolic process
GO:0046523 F S-methyl-5-thioribose-1-phosphate isomerase activity
GO:0051716 P cellular response to stimulus
RNA-seq EntryA_BomaMG_comp61696_c0_seq1
Sequence
(Amino Acid)
AGVALAARARKRPVLVACHTHKFIDSLYTDAFMHNQIGDPDDLLEKSDDNSPLKDWRSNL
NLTPLNLTYDVTPPCLITAVVTELAILPCTSAPVVLRFKLSEYGV
*(34 a.a.)

- SilkBase 1999-2023 -