SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG22862_internal:A_BomaMG_comp58036_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003824 F catalytic activity
GO:0004133 F glycogen debranching enzyme activity
GO:0004134 F 4-alpha-glucanotransferase activity
GO:0004135 F amylo-alpha-1,6-glucosidase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005975 P carbohydrate metabolic process
GO:0005977 P glycogen metabolic process
GO:0005978 P glycogen biosynthetic process
GO:0005980 P glycogen catabolic process
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0009725 P response to hormone
GO:0016234 C inclusion body
GO:0016529 C sarcoplasmic reticulum
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0030246 F carbohydrate binding
GO:0030247 F polysaccharide binding
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0043033 C isoamylase complex
GO:0051384 P response to glucocorticoid
RNA-seq EntryA_BomaMG_comp58036_c0_seq1
Sequence
(Amino Acid)
FAARPAAAVYLRRDLLAWGDSIKLRYGDKPEDSPFLWAHMREYVELTAEVFDGLRLDNCH
STPLHVAEYMLDCARNVKPDLYVVAELFTNSDQVDNIFVNRLGITSLIREAQSAWDSHEQ
GRLLHRFGGRGAGAFMWGGPRP
(46 a.a.)

- SilkBase 1999-2023 -