SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22847_complete:A_BomaMG_comp57008_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0030331 F estrogen receptor binding
GO:0033148 P positive regulation of intracellular estrogen receptor signaling pathway
GO:0035097 C histone methyltransferase complex
GO:0044666 C MLL3/4 complex
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048304 P positive regulation of isotype switching to IgG isotypes
GO:0060717 P chorion development
GO:0071557 P histone H3-K27 demethylation
GO:1902749 P regulation of cell cycle G2/M phase transition
GO:1902808 P positive regulation of cell cycle G1/S phase transition
GO:2001022 P positive regulation of response to DNA damage stimulus
RNA-seq EntryA_BomaMG_comp57008_c0_seq1
Sequence
(Amino Acid)
METEIQGDDWDIPCSDDELAKNGVFIGKSWMPEPAELEELYKNIDKKGILNLEWKCPGRR
QPSPVPVSKENQPELPQSPIREEKSDFDFMDEVSSLRLRVRREGEDTLRGSAKKKTTSFD
GILSNMIRHKRIEQMEKQAKTSPSTTSSN
*(49 a.a.)

- SilkBase 1999-2023 -