SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG22753_3prime_partial:A_BomaMG_comp48378_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000139 C Golgi membrane
GO:0000165 P MAPK cascade
GO:0000209 P protein polyubiquitination
GO:0000278 P mitotic cell cycle
GO:0000902 P cell morphogenesis
GO:0001701 P in utero embryonic development
GO:0001831 P trophectodermal cellular morphogenesis
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005827 C polar microtubule
GO:0005829 C cytosol
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006513 P protein monoubiquitination
GO:0006810 P transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007050 P regulation of cell cycle
GO:0007080 P mitotic metaphase plate congression
GO:0007229 P integrin-mediated signaling pathway
GO:0007369 P gastrulation
GO:0008054 P anaphase-promoting complex-dependent catabolic process
GO:0008284 P positive regulation of cell population proliferation
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016192 P vesicle-mediated transport
GO:0016477 P cell migration
GO:0016567 P protein ubiquitination
GO:0017145 P stem cell division
GO:0030030 P cell projection organization
GO:0030332 F cyclin binding
GO:0031208 F POZ domain binding
GO:0031461 C cullin-RING ubiquitin ligase complex
GO:0031463 C Cul3-RING ubiquitin ligase complex
GO:0031625 F ubiquitin protein ligase binding
GO:0032467 P positive regulation of cytokinesis
GO:0035024 P negative regulation of Rho protein signal transduction
GO:0040016 P embryonic cleavage
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042803 F protein homodimerization activity
GO:0043149 P stress fiber assembly
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044346 P fibroblast apoptotic process
GO:0045842 P positive regulation of mitotic metaphase/anaphase transition
GO:0046982 F protein heterodimerization activity
GO:0048208 P COPII vesicle coating
GO:0061630 F ubiquitin protein ligase activity
GO:0070062 C extracellular exosome
GO:0072576 P liver morphogenesis
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0097193 P intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp48378_c0_seq1
Sequence
(Amino Acid)
MMKSTLPKDKIPGKMRIRAFPMTMDEKYVERIWSLLKNAIQEIQKKNNSGLSFEELYRNA
YTMVLHKHGERLYTGLKEVVTQHLETKVREDVLHSLHNGFLQTLNNAWTDHQTSMVMIRD
ILMYMDRVFVQQNEVDNVYNLGLIIFRDQVVRYGCIRDHLRQTLLELVARERRGEVVDRL
AIRNACQMLMVLGINSRAVYEEDFEKPFLHQSSEFYRMESQKFLAENSAAVYINRVEARI
SEEAERARHYLDESTEPRVVSVLEHELIERHMKTIVEMENSGVVHMLTHTRTSELGCVYK
LLSRVGE
(101 a.a.)

- SilkBase 1999-2023 -