SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22635_5prime_partial:A_BomaMG_comp38983_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001205 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001933 P negative regulation of protein phosphorylation
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003723 F RNA binding
GO:0003730 F mRNA 3'-UTR binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005726 C perichromatin fibrils
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006397 P mRNA processing
GO:0008380 P RNA splicing
GO:0010629 P negative regulation of gene expression
GO:0016607 C nuclear speck
GO:0030264 P nuclear fragmentation involved in apoptotic nuclear change
GO:0032024 P positive regulation of insulin secretion
GO:0034976 P response to endoplasmic reticulum stress
GO:0035061 C interchromatin granule
GO:0042802 F identical protein binding
GO:0043922 P negative regulation by host of viral transcription
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051726 P regulation of cell cycle
GO:0070935 P 3'-UTR-mediated mRNA stabilization
GO:0071765 P nuclear inner membrane organization
RNA-seq EntryA_BomaMG_comp38983_c0_seq1
Sequence
(Amino Acid)
ARHVIRHIRHEYYKNFWLDLQNNILLIQELGLNQSLKAVRVDKRDEEVEGQRWSVSKMTE
YVPVSEGEQDEPIELPTEEDGSLLLSTVAAQFAGASGLKYRVNGRLRGVRLVDERLSPPA
EGWPAYRYWCAFPRAESPPPRPRCSDLIVLGLPWKTTEEAVRDYFSSFGDLLMVQVKRDT
RTGLSKGFGFIKFAEYEAQLRALGRRHMIDGRWCDVRIPNGKDGSSTAHRKVFVGRCTEN
ITAEDLREYFGSFGQVTDVFVPRPFRAFSFVTFLDPEVARSLCGQDHIIKGVSVNISTAS
PKRERSTTAASGLGWGRMLGWPADAWPLPAPHPLESKPYLKYE
*(113 a.a.)

- SilkBase 1999-2023 -