SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22596_internal:A_BomaMG_comp37638_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000062 F fatty-acyl-CoA binding
GO:0001659 P temperature homeostasis
GO:0003995 F acyl-CoA dehydrogenase activity
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0008152 P metabolic process
GO:0009055 F electron transfer activity
GO:0016020 C membrane
GO:0016491 F oxidoreductase activity
GO:0016627 F oxidoreductase activity, acting on the CH-CH group of donors
GO:0017099 F very-long-chain-acyl-CoA dehydrogenase activity
GO:0030855 P epithelial cell differentiation
GO:0033539 P fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0042645 C mitochondrial nucleoid
GO:0042760 P very long-chain fatty acid catabolic process
GO:0045717 P negative regulation of fatty acid biosynthetic process
GO:0046322 P negative regulation of fatty acid oxidation
GO:0050660 F flavin adenine dinucleotide binding
GO:0052890 F oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor
GO:0055088 P lipid homeostasis
GO:0055114 P obsolete oxidation-reduction process
GO:0090181 P regulation of cholesterol metabolic process
RNA-seq EntryA_BomaMG_comp37638_c0_seq1
Sequence
(Amino Acid)
AAQHAATRVQFGKHLAEFGAVQEKLARMAMLQYATEALAYMVSGNMDSGAQDYHLEAAIS
KVFASDSAWTVVDEAIQILGGMGYMKATGLERVLRDLRIFRIFEGTNDILRLFVALTGIQ
FAGSHLQELQRAFKNPTAHLGLIFSEAGRRATAAVGLAR
(52 a.a.)

- SilkBase 1999-2023 -