SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22592_3prime_partial:A_BomaMG_comp37501_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002625 P regulation of T cell antigen processing and presentation
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005911 C cell-cell junction
GO:0006461 P protein-containing complex assembly
GO:0006952 P defense response
GO:0006955 P immune response
GO:0007015 P actin filament organization
GO:0007596 P blood coagulation
GO:0008154 P actin polymerization or depolymerization
GO:0008544 P epidermis development
GO:0012506 C vesicle membrane
GO:0015629 C actin cytoskeleton
GO:0016197 P endosomal transport
GO:0017124 F SH3 domain binding
GO:0019901 F protein kinase binding
GO:0030041 P actin filament polymerization
GO:0030048 P actin filament-based movement
GO:0030695 F GTPase regulator activity
GO:0038096 P Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0042110 P T cell activation
GO:0042802 F identical protein binding
GO:0043274 F phospholipase binding
GO:0050790 P regulation of catalytic activity
GO:0050852 P T cell receptor signaling pathway
GO:0070062 C extracellular exosome
GO:2000146 P negative regulation of cell motility
GO:2000601 P positive regulation of Arp2/3 complex-mediated actin nucleation
RNA-seq EntryA_BomaMG_comp37501_c0_seq1
Sequence
(Amino Acid)
MPRGEHRTTNLLSREENEQVFSLIGPKCQSLATTVVQLFTTEGPAHSEWKKRDTGVLCLI
KDNGKRSYFFRIYCLYRKAMIWEHEVYMQIEYKNPRPYLHTFEAEEYMTAFNFANEEEAQ
ILKKILIEKIELRKTRREERRQRALTAARANSVVEPRQNGVLPPPPALEPEPAPVLPPKT
NLAGTYTLKSSGKRKTTRKLTKADIGMPHNFTHVSHIGWDKDKGFDVETTQDEKLLSFLK
EAGVSEVHLRDQETRKFIYSFIETNGGINAVMEDLHTNNEKPIKERSAPSRAPAPPVPQ
(98 a.a.)

- SilkBase 1999-2023 -