SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22580_complete:A_BomaMG_comp36677_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0003713 F transcription coactivator activity
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005923 C bicellular tight junction
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0019003 F GDP binding
GO:0030336 P negative regulation of cell migration
GO:0031954 P positive regulation of protein autophosphorylation
GO:0032486 P Rap protein signal transduction
GO:0044291 C cell-cell contact zone
GO:0055037 C recycling endosome
GO:0055038 C recycling endosome membrane
GO:0061097 P regulation of protein tyrosine kinase activity
GO:0070062 C extracellular exosome
GO:0090557 P establishment of endothelial intestinal barrier
GO:1903506 P regulation of nucleic acid-templated transcription
RNA-seq EntryA_BomaMG_comp36677_c0_seq1
Sequence
(Amino Acid)
MREFKVVVLGSGGVGKSALTVQFVSGCFMEKYDPTIEDFYRKEIEVDNSPCVLEILDTAG
TEQFASMRDLYIKNGQGFVVVYSLTNHQTFQDIKPMKELITRVKGSERVPILLVGNKADL
EHQREVAHAEGAALAQMWGCPFVEASAKSRTNVNEMFAEIVREMNVSPEKEKPYCCCTVL
*(59 a.a.)

- SilkBase 1999-2023 -