SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22564_internal:A_BomaMG_comp36000_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001754 P eye photoreceptor cell differentiation
GO:0003774 F cytoskeletal motor activity
GO:0003777 F microtubule motor activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0006886 P intracellular protein transport
GO:0007018 P microtubule-based movement
GO:0007269 P neurotransmitter secretion
GO:0007303 P cytoplasmic transport, nurse cell to oocyte
GO:0007310 P oocyte dorsal/ventral axis specification
GO:0007315 P pole plasm assembly
GO:0007317 P regulation of pole plasm oskar mRNA localization
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0008017 F microtubule binding
GO:0008088 P axo-dendritic transport
GO:0008103 P oocyte microtubule cytoskeleton polarization
GO:0008152 P metabolic process
GO:0008345 P larval locomotory behavior
GO:0008574 F plus-end-directed microtubule motor activity
GO:0010970 P transport along microtubule
GO:0016482 P cytosolic transport
GO:0019227 P neuronal action potential propagation
GO:0030011 P maintenance of cell polarity
GO:0030478 C actin cap
GO:0035371 C microtubule plus-end
GO:0035617 P stress granule disassembly
GO:0040023 P nuclear migration
GO:0043005 C neuron projection
GO:0045451 P pole plasm oskar mRNA localization
GO:0046785 P microtubule polymerization
GO:0046843 P dorsal appendage formation
GO:0047497 P mitochondrion transport along microtubule
GO:0048311 P mitochondrion distribution
GO:0048312 P intracellular distribution of mitochondria
GO:0048741 P skeletal muscle fiber development
GO:0048812 P neuron projection morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0051012 P microtubule sliding
GO:0051299 P centrosome separation
GO:0061572 P actin filament bundle organization
GO:0098793 C presynapse
RNA-seq EntryA_BomaMG_comp36000_c0_seq1
Sequence
(Amino Acid)
LEAQLEQLRAAHSTQLSALRDELAALQRQHQDLKDTYQELTLARQQLQDDYEKLKREEAD
KSAKLKELIQSVERREQARADLKGLEDTVAKELQTLHNLRKLFVQDLQARIKKSNNSEEG
AEEEGGSLAQKQKISFLENNLEQLTKVHKQLVRDNADLRCEVPKLEKRLRATMERVKALE
TALKEAKDGAMRDRKRYQFEVDRIKEAVRAKNLARRGPQAQIAKPIRAGGGHLAGGAGA
(78 a.a.)

- SilkBase 1999-2023 -