SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22493_5prime_partial:A_BomaMG_comp32222_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001726 C ruffle
GO:0003096 P renal sodium ion transport
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005886 C plasma membrane
GO:0005902 C microvillus
GO:0006461 P protein-containing complex assembly
GO:0007191 P adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007605 P sensory perception of sound
GO:0008013 F beta-catenin binding
GO:0008285 P negative regulation of cell population proliferation
GO:0008360 P regulation of cell shape
GO:0008361 P regulation of cell size
GO:0010642 P negative regulation of platelet-derived growth factor receptor signaling pathway
GO:0010766 P negative regulation of sodium ion transport
GO:0012505 C endomembrane system
GO:0014067 P negative regulation of phosphatidylinositol 3-kinase signaling
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016324 C apical plasma membrane
GO:0017081 F chloride channel regulator activity
GO:0019902 F phosphatase binding
GO:0019904 F protein domain specific binding
GO:0019933 P cAMP-mediated signaling
GO:0022612 P gland morphogenesis
GO:0030033 P microvillus assembly
GO:0030036 P actin cytoskeleton organization
GO:0030165 F PDZ domain binding
GO:0030175 C filopodium
GO:0030336 P negative regulation of cell migration
GO:0030643 P cellular phosphate ion homeostasis
GO:0031526 C brush border membrane
GO:0031528 C microvillus membrane
GO:0031698 F beta-2 adrenergic receptor binding
GO:0031982 C vesicle
GO:0032403 F protein-containing complex binding
GO:0032415 P regulation of sodium:proton antiporter activity
GO:0032416 P negative regulation of sodium:proton antiporter activity
GO:0032420 C stereocilium
GO:0032426 C stereocilium tip
GO:0032782 P bile acid secretion
GO:0032947 F molecular adaptor activity
GO:0034613 P cellular protein localization
GO:0034635 P glutathione transport
GO:0035414 P negative regulation of canonical Wnt signaling pathway
GO:0040023 P nuclear migration
GO:0042995 C cell projection
GO:0043231 C intracellular membrane-bounded organelle
GO:0043621 F protein self-association
GO:0044062 P regulation of excretion
GO:0045121 C membrane raft
GO:0045177 C apical part of cell
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0045859 P regulation of protein kinase activity
GO:0045930 P negative regulation of mitotic cell cycle
GO:0048471 C perinuclear region of cytoplasm
GO:0050780 F dopamine receptor binding
GO:0051683 P establishment of Golgi localization
GO:0051898 P negative regulation of protein kinase B signaling
GO:0060088 P auditory receptor cell stereocilium organization
GO:0060158 P phospholipase C-activating dopamine receptor signaling pathway
GO:0070062 C extracellular exosome
GO:0070293 P renal absorption
GO:0070373 P negative regulation of ERK1 and ERK2 cascade
GO:0070851 F growth factor receptor binding
GO:0071944 C cell periphery
GO:0090002 P protein localization to plasma membrane
GO:0097225 C sperm midpiece
GO:0097291 P renal phosphate ion absorption
GO:2000146 P negative regulation of cell motility
GO:2001244 P positive regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp32222_c0_seq1
Sequence
(Amino Acid)
ARRARRGRPAVSPRERAALLARTPTTDMSANGSAAIEPRLCHVRKTPDFDGYGFNLHAEK
GKPGQYIGKVDDGSPAETAGLKRGDRILEVNGHSIAGETHKQVVARIKERPDDAELLVIA
PAPGDQMPDLDVPVPEKTPPPSEAPRDSPSPTEPPKLNLQMTAAEMRAHLAAKKKFDPKK
VPMDLRSKFDIVKKL
*(64 a.a.)

- SilkBase 1999-2023 -